Lineage for d5c7ha_ (5c7h A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2437818Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2438355Family c.1.7.0: automated matches [191491] (1 protein)
    not a true family
  6. 2438356Protein automated matches [190793] (30 species)
    not a true protein
  7. 2438468Species Rhizobium meliloti [TaxId:266834] [257512] (3 PDB entries)
  8. 2438469Domain d5c7ha_: 5c7h A: [274728]
    automated match to d4pmja_
    complexed with ndp

Details for d5c7ha_

PDB Entry: 5c7h (more details), 1.3 Å

PDB Description: crystal structure of aldo-keto reductase from sinorhizobium meliloti 1021 in complex with nadph
PDB Compounds: (A:) aldo-keto reductase

SCOPe Domain Sequences for d5c7ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c7ha_ c.1.7.0 (A:) automated matches {Rhizobium meliloti [TaxId: 266834]}
mhdpiptiafpdgrkvpalgqgtwrmgenraktadevrslqtgldlgmtlidtaemygdg
aaerivgeaikgrrdeafvvskvlpsnasragtvaacerslrnlgidcvdlyllhwrggy
plaetvaafeelkkagkirawgvsnfdvddmeelsavpdggnvaanqvlynlarrgiefd
llprcraqgvpvmayspldegrllhdadlihiakahqatpaqvalaflktcsgvisipkt
gsperarenrdamdihlttenlaeldrhfppprrktrlevi

SCOPe Domain Coordinates for d5c7ha_:

Click to download the PDB-style file with coordinates for d5c7ha_.
(The format of our PDB-style files is described here.)

Timeline for d5c7ha_: