Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) |
Family c.1.7.0: automated matches [191491] (1 protein) not a true family |
Protein automated matches [190793] (31 species) not a true protein |
Species Rhizobium meliloti [TaxId:266834] [257512] (3 PDB entries) |
Domain d5c7ha_: 5c7h A: [274728] automated match to d4pmja_ complexed with ndp |
PDB Entry: 5c7h (more details), 1.3 Å
SCOPe Domain Sequences for d5c7ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c7ha_ c.1.7.0 (A:) automated matches {Rhizobium meliloti [TaxId: 266834]} mhdpiptiafpdgrkvpalgqgtwrmgenraktadevrslqtgldlgmtlidtaemygdg aaerivgeaikgrrdeafvvskvlpsnasragtvaacerslrnlgidcvdlyllhwrggy plaetvaafeelkkagkirawgvsnfdvddmeelsavpdggnvaanqvlynlarrgiefd llprcraqgvpvmayspldegrllhdadlihiakahqatpaqvalaflktcsgvisipkt gsperarenrdamdihlttenlaeldrhfppprrktrlevi
Timeline for d5c7ha_: