Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) |
Family c.1.7.0: automated matches [191491] (1 protein) not a true family |
Protein automated matches [190793] (30 species) not a true protein |
Species Rhizobium meliloti [TaxId:266834] [257512] (3 PDB entries) |
Domain d4pmja_: 4pmj A: [257513] automated match to d2wzma_ complexed with gol, nap |
PDB Entry: 4pmj (more details), 2.2 Å
SCOPe Domain Sequences for d4pmja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pmja_ c.1.7.0 (A:) automated matches {Rhizobium meliloti [TaxId: 266834]} mhdpiptiafpdgrkvpalgqgtwrmgenraktadevrslqtgldlgmtlidtaemygdg aaerivgeaikgrrdeafvvskvlpsnasragtvaacerslrnlgidcvdlyllhwrggy plaetvaafeelkkagkirawgvsnfdvddmeelsavpdggnvaanqvlynlarrgiefd llprcraqgvpvmayspldegrllhdadlihiakahqatpaqvalaflktcsgvisipkt gsperarenrdamdihlttenlaeldrhfppprrktrlevi
Timeline for d4pmja_: