Lineage for d4pmja_ (4pmj A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080913Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2081379Family c.1.7.0: automated matches [191491] (1 protein)
    not a true family
  6. 2081380Protein automated matches [190793] (26 species)
    not a true protein
  7. 2081472Species Rhizobium meliloti [TaxId:266834] [257512] (3 PDB entries)
  8. 2081474Domain d4pmja_: 4pmj A: [257513]
    automated match to d2wzma_
    complexed with gol, nap

Details for d4pmja_

PDB Entry: 4pmj (more details), 2.2 Å

PDB Description: crystal structure of a putative oxidoreductase from sinorhizobium meliloti 1021 in complex with nadp
PDB Compounds: (A:) Putative oxidoreductase

SCOPe Domain Sequences for d4pmja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pmja_ c.1.7.0 (A:) automated matches {Rhizobium meliloti [TaxId: 266834]}
mhdpiptiafpdgrkvpalgqgtwrmgenraktadevrslqtgldlgmtlidtaemygdg
aaerivgeaikgrrdeafvvskvlpsnasragtvaacerslrnlgidcvdlyllhwrggy
plaetvaafeelkkagkirawgvsnfdvddmeelsavpdggnvaanqvlynlarrgiefd
llprcraqgvpvmayspldegrllhdadlihiakahqatpaqvalaflktcsgvisipkt
gsperarenrdamdihlttenlaeldrhfppprrktrlevi

SCOPe Domain Coordinates for d4pmja_:

Click to download the PDB-style file with coordinates for d4pmja_.
(The format of our PDB-style files is described here.)

Timeline for d4pmja_: