| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) ![]() |
| Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
| Protein Suppressor of cytokine signaling 2, SOCS-2 [160562] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [160563] (2 PDB entries) Uniprot O14508 32-134 |
| Domain d5bo4j1: 5bo4 J:31-134 [274696] Other proteins in same PDB: d5bo4a2, d5bo4b_, d5bo4c_, d5bo4d2, d5bo4e_, d5bo4f_, d5bo4g2, d5bo4h_, d5bo4i_, d5bo4j2, d5bo4k_, d5bo4l_, d5bo4m2, d5bo4o_, d5bo4p2, d5bo4q_, d5bo4r_ automated match to d2c9wa2 |
PDB Entry: 5bo4 (more details), 2.9 Å
SCOPe Domain Sequences for d5bo4j1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5bo4j1 d.93.1.1 (J:31-134) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]}
mqaarlakalrelgqtgwywgsmtvneakeklkeapegtflirdsshsdylltisvktsa
gptnlrieyqdgkfrldsiicvksklkqfdsvvhlidyyvqmck
Timeline for d5bo4j1: