Lineage for d5bo4j1 (5bo4 J:32-134)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965229Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2965595Protein Suppressor of cytokine signaling 2, SOCS-2 [160562] (1 species)
  7. 2965596Species Human (Homo sapiens) [TaxId:9606] [160563] (2 PDB entries)
    Uniprot O14508 32-134
  8. 2965601Domain d5bo4j1: 5bo4 J:32-134 [274696]
    Other proteins in same PDB: d5bo4a2, d5bo4a3, d5bo4b_, d5bo4c1, d5bo4c2, d5bo4d2, d5bo4d3, d5bo4e_, d5bo4f_, d5bo4g2, d5bo4g3, d5bo4h_, d5bo4i1, d5bo4i2, d5bo4j2, d5bo4j3, d5bo4k_, d5bo4l1, d5bo4l2, d5bo4m2, d5bo4o_, d5bo4p2, d5bo4q_, d5bo4r_
    automated match to d2c9wa2

Details for d5bo4j1

PDB Entry: 5bo4 (more details), 2.9 Å

PDB Description: structure of socs2:elongin c:elongin b from dmso-treated crystals
PDB Compounds: (J:) suppressor of cytokine signaling 2

SCOPe Domain Sequences for d5bo4j1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bo4j1 d.93.1.1 (J:32-134) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]}
qaarlakalrelgqtgwywgsmtvneakeklkeapegtflirdsshsdylltisvktsag
ptnlrieyqdgkfrldsiicvksklkqfdsvvhlidyyvqmck

SCOPe Domain Coordinates for d5bo4j1:

Click to download the PDB-style file with coordinates for d5bo4j1.
(The format of our PDB-style files is described here.)

Timeline for d5bo4j1: