SCOPe 2.05: Domain d5bo4b_: 5bo4 B:

Lineage for d5bo4b_ (5bo4 B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (9 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein Elongin B [54246] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54247] (27 PDB entries)

8. Domain d5bo4b_: 5bo4 B: [274683]
   Other proteins in same PDB: d5bo4a1, d5bo4a2, d5bo4c_, d5bo4d1, d5bo4d2, d5bo4f_, d5bo4g1, d5bo4g2, d5bo4i_, d5bo4j1, d5bo4j2, d5bo4l_, d5bo4m1, d5bo4m2, d5bo4o_, d5bo4p1, d5bo4p2, d5bo4r_
   automated match to d1lqba_

Details for d5bo4b_

PDB Entry: 5bo4, 2.9 Å

PDB Description: structure of socs2:elongin c:elongin b from dmso-treated crystals

PDB Compounds: (B:) Transcription elongation factor B polypeptide 2

SCOPe Domain Sequences for d5bo4b_:

Sequence; same for both SEQRES and ATOM records:

>d5bo4b_ d.15.1.1 (B:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
dvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgecg
ftsqtarpqapatvglafraddtfealciepfssppelpdvmk

Timeline for d5bo4b_:

• d5bo4b_ is new in SCOPe 2.05-stable
  
• d5bo4b_ appears in SCOPe 2.06
  
• d5bo4b_ appears in the current release, SCOPe 2.08