| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) ![]() different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
| Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins) |
| Protein Protein phosphatase-1 (PP-1) [56311] (6 species) |
| Species Human (Homo sapiens), gamma isoform [TaxId:9606] [111230] (17 PDB entries) Uniprot P37140 1-308 |
| Domain d4xpnc1: 4xpn C:7-299 [274552] Other proteins in same PDB: d4xpna2, d4xpnc2 automated match to d1s70a_ complexed with gol, mn, po4 |
PDB Entry: 4xpn (more details), 2.29 Å
SCOPe Domain Sequences for d4xpnc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xpnc1 d.159.1.3 (C:7-299) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
lnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplkicgdih
gqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnhe
casinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeqi
rrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhdldlicr
ahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpa
Timeline for d4xpnc1: