Lineage for d4xpnc1 (4xpn C:7-299)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2603960Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2603961Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2604064Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)
  6. 2604090Protein Protein phosphatase-1 (PP-1) [56311] (6 species)
  7. 2604112Species Human (Homo sapiens), gamma isoform [TaxId:9606] [111230] (17 PDB entries)
    Uniprot P37140 1-308
  8. 2604138Domain d4xpnc1: 4xpn C:7-299 [274552]
    Other proteins in same PDB: d4xpna2, d4xpnc2
    automated match to d1s70a_
    complexed with gol, mn, po4

Details for d4xpnc1

PDB Entry: 4xpn (more details), 2.29 Å

PDB Description: crystal structure of protein phosphate 1 complexed with pp1 binding domain of gadd34
PDB Compounds: (C:) Serine/threonine-protein phosphatase PP1-alpha catalytic subunit

SCOPe Domain Sequences for d4xpnc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xpnc1 d.159.1.3 (C:7-299) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
lnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplkicgdih
gqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnhe
casinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeqi
rrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhdldlicr
ahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpa

SCOPe Domain Coordinates for d4xpnc1:

Click to download the PDB-style file with coordinates for d4xpnc1.
(The format of our PDB-style files is described here.)

Timeline for d4xpnc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4xpnc2