SCOPe 2.06: Domain d4xpnc1: 4xpn C:7-299

Lineage for d4xpnc1 (4xpn C:7-299)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)

6. Protein Protein phosphatase-1 (PP-1) [56311] (5 species)

7. Species Human (Homo sapiens), gamma isoform [TaxId:9606] [111230] (5 PDB entries)
   Uniprot P37140 1-308

8. Domain d4xpnc1: 4xpn C:7-299 [274552]
   Other proteins in same PDB: d4xpna2, d4xpnc2
   automated match to d1s70a_
   complexed with gol, mn, po4

Details for d4xpnc1

PDB Entry: 4xpn, 2.29 Å

PDB Description: crystal structure of protein phosphate 1 complexed with pp1 binding domain of gadd34

PDB Compounds: (C:) Serine/threonine-protein phosphatase PP1-alpha catalytic subunit

SCOPe Domain Sequences for d4xpnc1:

Sequence; same for both SEQRES and ATOM records:

>d4xpnc1 d.159.1.3 (C:7-299) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
lnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplkicgdih
gqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnhe
casinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeqi
rrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhdldlicr
ahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpa

Timeline for d4xpnc1:

• d4xpnc1 first appeared in SCOPe 2.05, called d4xpnc_
  
• d4xpnc1 appears in SCOPe 2.07
  
• d4xpnc1 appears in the current release, SCOPe 2.08