Lineage for d4xpnc_ (4xpn C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1938246Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 1938247Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 1938325Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)
  6. 1938351Protein Protein phosphatase-1 (PP-1) [56311] (5 species)
  7. 1938373Species Human (Homo sapiens), gamma isoform [TaxId:9606] [111230] (3 PDB entries)
    Uniprot P37140 1-308
  8. 1938378Domain d4xpnc_: 4xpn C: [274552]
    automated match to d1s70a_
    complexed with gol, mn, po4

Details for d4xpnc_

PDB Entry: 4xpn (more details), 2.29 Å

PDB Description: crystal structure of protein phosphate 1 complexed with pp1 binding domain of gadd34
PDB Compounds: (C:) Serine/threonine-protein phosphatase PP1-alpha catalytic subunit

SCOPe Domain Sequences for d4xpnc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xpnc_ d.159.1.3 (C:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
slnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplkicgdi
hgqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnh
ecasinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeq
irrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhdldlic
rahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpa

SCOPe Domain Coordinates for d4xpnc_:

Click to download the PDB-style file with coordinates for d4xpnc_.
(The format of our PDB-style files is described here.)

Timeline for d4xpnc_: