SCOPe 2.05: Domain d4xpna_: 4xpn A:

Lineage for d4xpna_ (4xpn A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)

6. Protein Protein phosphatase-1 (PP-1) [56311] (5 species)

7. Species Human (Homo sapiens), gamma isoform [TaxId:9606] [111230] (3 PDB entries)
   Uniprot P37140 1-308

8. Domain d4xpna_: 4xpn A: [274551]
   automated match to d1s70a_
   complexed with gol, mn, po4

Details for d4xpna_

PDB Entry: 4xpn, 2.29 Å

PDB Description: crystal structure of protein phosphate 1 complexed with pp1 binding domain of gadd34

PDB Compounds: (A:) Serine/threonine-protein phosphatase PP1-alpha catalytic subunit

SCOPe Domain Sequences for d4xpna_:

Sequence; same for both SEQRES and ATOM records:

>d4xpna_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), gamma isoform [TaxId: 9606]}
mgslnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplkicg
dihgqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrg
nhecasinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsm
eqirrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhdldl
icrahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpa

Timeline for d4xpna_:

• d4xpna_ is new in SCOPe 2.05-stable
  
• d4xpna_ is called d4xpna1 in SCOPe 2.06
  
• d4xpna_ appears in the current release, SCOPe 2.08, called d4xpna1