![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
![]() | Superfamily b.62.1: Cyclophilin-like [50891] (5 families) ![]() |
![]() | Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins) automatically mapped to Pfam PF00160 |
![]() | Protein Cyclophilin (eukaryotic) [50893] (13 species) |
![]() | Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (136 PDB entries) Uniprot P05092 |
![]() | Domain d2rmam_: 2rma M: [27441] |
PDB Entry: 2rma (more details), 2.1 Å
SCOPe Domain Sequences for d2rmam_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rmam_ b.62.1.1 (M:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A [TaxId: 9606]} mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
Timeline for d2rmam_: