SCOPe 2.07: Domain d4qota_: 4qot A:

Lineage for d4qota_ (4qot A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families)

5. Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins)

6. Protein ATX1 metallochaperone protein (ATOX1) [55014] (3 species)

7. Species Human (Homo sapiens), HAH1 [TaxId:9606] [55016] (15 PDB entries)
   Uniprot O00244

8. Domain d4qota_: 4qot A: [274261]
   automated match to d1fe0b_
   complexed with pt, so4

Details for d4qota_

PDB Entry: 4qot, 2.2 Å

PDB Description: crystal structure of human copper chaperone bound to the platinum ion

PDB Compounds: (A:) copper transport protein atox1

SCOPe Domain Sequences for d4qota_:

Sequence; same for both SEQRES and ATOM records:

>d4qota_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]}
pkhefsvdmtcggcaeavsrvlnklggvkydidlpnkkvciesehsmdtllatlkktgkt
vsylgle

Timeline for d4qota_:

• d4qota_ first appeared in SCOPe 2.05
  
• d4qota_ appears in SCOPe 2.06
  
• d4qota_ appears in the current release, SCOPe 2.08