Lineage for d4qota_ (4qot A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953868Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 2953869Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins)
  6. 2953870Protein ATX1 metallochaperone protein (ATOX1) [55014] (3 species)
  7. 2953902Species Human (Homo sapiens), HAH1 [TaxId:9606] [55016] (17 PDB entries)
    Uniprot O00244
  8. 2953916Domain d4qota_: 4qot A: [274261]
    automated match to d1fe0b_
    complexed with pt, so4

Details for d4qota_

PDB Entry: 4qot (more details), 2.2 Å

PDB Description: crystal structure of human copper chaperone bound to the platinum ion
PDB Compounds: (A:) copper transport protein atox1

SCOPe Domain Sequences for d4qota_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qota_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]}
pkhefsvdmtcggcaeavsrvlnklggvkydidlpnkkvciesehsmdtllatlkktgkt
vsylgle

SCOPe Domain Coordinates for d4qota_:

Click to download the PDB-style file with coordinates for d4qota_.
(The format of our PDB-style files is described here.)

Timeline for d4qota_: