| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) ![]() |
| Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins) |
| Protein ATX1 metallochaperone protein (ATOX1) [55014] (3 species) |
| Species Human (Homo sapiens), HAH1 [TaxId:9606] [55016] (15 PDB entries) Uniprot O00244 |
| Domain d1fe0b_: 1fe0 B: [39346] complexed with cd, so4, suc |
PDB Entry: 1fe0 (more details), 1.75 Å
SCOPe Domain Sequences for d1fe0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fe0b_ d.58.17.1 (B:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]}
mpkhefsvdmtcggcaeavsrvlnklggvkydidlpnkkvciesehsmdtllatlkktgk
tvsylgle
Timeline for d1fe0b_: