| Class b: All beta proteins [48724] (93 folds) |
| Fold b.62: Cyclophilin (peptidylprolyl isomerase) [50890] (1 superfamily) |
Superfamily b.62.1: Cyclophilin (peptidylprolyl isomerase) [50891] (1 family) ![]() |
| Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (2 proteins) |
| Protein Cyclophilin (eukaryotic) [50893] (7 species) |
| Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (33 PDB entries) |
| Domain d1cwla_: 1cwl A: [27423] |
PDB Entry: 1cwl (more details), 1.8 Å
SCOP Domain Sequences for d1cwla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cwla_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A}
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
Timeline for d1cwla_: