Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
Protein automated matches [190233] (31 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [189205] (17 PDB entries) |
Domain d4zrkd1: 4zrk D:19-103 [274126] Other proteins in same PDB: d4zrka2, d4zrka3, d4zrkb2, d4zrkb3, d4zrkc2, d4zrkc3, d4zrkd2, d4zrkd3 automated match to d1h4ra3 |
PDB Entry: 4zrk (more details), 2.32 Å
SCOPe Domain Sequences for d4zrkd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zrkd1 d.15.1.0 (D:19-103) automated matches {Mouse (Mus musculus) [TaxId: 10090]} pktftvrivtmdaemefncemkwkgkdlfdlvcrtlglretwffglqytikdtvawlkmd kkvldhdvskeepvtfhflakfype
Timeline for d4zrkd1: