PDB entry 4zrk

View 4zrk on RCSB PDB site
Description: Merlin-FERM and Lats1 complex
Class: signaling protein/transferase
Keywords: Merlin, FERM, Lats1, SIGNALING PROTEIN-TRANSFERASE complex
Deposited on 2015-05-12, released 2015-06-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-07-15, with a file datestamp of 2015-07-10.
Experiment type: XRAY
Resolution: 2.32 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: merlin
    Species: Mus musculus [TaxId:10090]
    Gene: Nf2, Nf-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4zrka1, d4zrka2, d4zrka3
  • Chain 'B':
    Compound: merlin
    Species: Mus musculus [TaxId:10090]
    Gene: Nf2, Nf-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4zrkb1, d4zrkb2, d4zrkb3
  • Chain 'C':
    Compound: merlin
    Species: Mus musculus [TaxId:10090]
    Gene: Nf2, Nf-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4zrkc1, d4zrkc2, d4zrkc3
  • Chain 'D':
    Compound: merlin
    Species: Mus musculus [TaxId:10090]
    Gene: Nf2, Nf-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4zrkd1, d4zrkd2, d4zrkd3
  • Chain 'E':
    Compound: Serine/threonine-protein kinase LATS1
    Species: Homo sapiens [TaxId:9606]
    Gene: LATS1, WARTS
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Serine/threonine-protein kinase LATS1
    Species: Homo sapiens [TaxId:9606]
    Gene: LATS1, WARTS
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Serine/threonine-protein kinase LATS1
    Species: Homo sapiens [TaxId:9606]
    Gene: LATS1, WARTS
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Serine/threonine-protein kinase LATS1
    Species: Homo sapiens [TaxId:9606]
    Gene: LATS1, WARTS
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4zrkA (A:)
    gpgsmagaiasrmsfsslkrkqpktftvrivtmdaemefncemkwkgkdlfdlvcrtlgl
    retwffglqytikdtvawlkmdkkvldhdvskeepvtfhflakfypenaeeelvqeitqh
    lfflqvkkqildekvycppeasvllasyavqakygdydpsvhkrgflaqeellpkrvinl
    yqmtpemweeritawyaehrgrardeaemeylkiaqdlemygvnyftirnkkgtelllgv
    dalglhiydpenrltpkisfpwneirnisysdkeftikpldkkidvfkfnssklrvnkli
    lqlcignhdlfmrrrkadslevqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zrkA (A:)
    ktftvrivtmdaemefncemkwkgkdlfdlvcrtlglretwffglqytikdtvawlkmdk
    kvldhdvskeepvtfhflakfypenaeeelvqeitqhlfflqvkkqildekvycppeasv
    llasyavqakygdydpsvhkrgflaqeellpkrvinlyqmtpemweeritawyaehrgra
    rdeaemeylkiaqdlemygvnyftirnkkgtelllgvdalglhiydpenrltpkisfpwn
    eirnisysdkeftikpldkkidvfkfnssklrvnklilqlcignhdlfmrrr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4zrkB (B:)
    gpgsmagaiasrmsfsslkrkqpktftvrivtmdaemefncemkwkgkdlfdlvcrtlgl
    retwffglqytikdtvawlkmdkkvldhdvskeepvtfhflakfypenaeeelvqeitqh
    lfflqvkkqildekvycppeasvllasyavqakygdydpsvhkrgflaqeellpkrvinl
    yqmtpemweeritawyaehrgrardeaemeylkiaqdlemygvnyftirnkkgtelllgv
    dalglhiydpenrltpkisfpwneirnisysdkeftikpldkkidvfkfnssklrvnkli
    lqlcignhdlfmrrrkadslevqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zrkB (B:)
    pktftvrivtmdaemefncemkwkgkdlfdlvcrtlglretwffglqytikdtvawlkmd
    kkvldhdvskeepvtfhflakfypenaeeelvqeitqhlfflqvkkqildekvycppeas
    vllasyavqakygdydpsvhkrgflaqeellpkrvinlyqmtpemweeritawyaehrgr
    ardeaemeylkiaqdlemygvnyftirnkkgtelllgvdalglhiydpenrltpkisfpw
    neirnisysdkeftikpldkkidvfkfnssklrvnklilqlcignhdlfmrrr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4zrkC (C:)
    gpgsmagaiasrmsfsslkrkqpktftvrivtmdaemefncemkwkgkdlfdlvcrtlgl
    retwffglqytikdtvawlkmdkkvldhdvskeepvtfhflakfypenaeeelvqeitqh
    lfflqvkkqildekvycppeasvllasyavqakygdydpsvhkrgflaqeellpkrvinl
    yqmtpemweeritawyaehrgrardeaemeylkiaqdlemygvnyftirnkkgtelllgv
    dalglhiydpenrltpkisfpwneirnisysdkeftikpldkkidvfkfnssklrvnkli
    lqlcignhdlfmrrrkadslevqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zrkC (C:)
    pktftvrivtmdaemefncemkwkgkdlfdlvcrtlglretwffglqytikdtvawlkmd
    kkvldhdvskeepvtfhflakfypenaeeelvqeitqhlfflqvkkqildekvycppeas
    vllasyavqakygdydpsvhkrgflaqeellpkrvinlyqmtpemweeritawyaehrgr
    ardeaemeylkiaqdlemygvnyftirnkkgtelllgvdalglhiydpenrltpkisfpw
    neirnisysdkeftikpldkkidvfkfnssklrvnklilqlcignhdlfmrrrka
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4zrkD (D:)
    gpgsmagaiasrmsfsslkrkqpktftvrivtmdaemefncemkwkgkdlfdlvcrtlgl
    retwffglqytikdtvawlkmdkkvldhdvskeepvtfhflakfypenaeeelvqeitqh
    lfflqvkkqildekvycppeasvllasyavqakygdydpsvhkrgflaqeellpkrvinl
    yqmtpemweeritawyaehrgrardeaemeylkiaqdlemygvnyftirnkkgtelllgv
    dalglhiydpenrltpkisfpwneirnisysdkeftikpldkkidvfkfnssklrvnkli
    lqlcignhdlfmrrrkadslevqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4zrkD (D:)
    pktftvrivtmdaemefncemkwkgkdlfdlvcrtlglretwffglqytikdtvawlkmd
    kkvldhdvskeepvtfhflakfypenaeeelvqeitqhlfflqvkkqildekvycppeas
    vllasyavqakygdydpsvhkrgflaqeellpkrvinlyqmtpemweeritawyaehrgr
    ardeaemeylkiaqdlemygvnyftirnkkgtelllgvdalglhiydpenrltpkisfpw
    neirnisysdkeftikpldkkidvfkfnssklrvnklilqlcignhdlfmrrr
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.