Lineage for d4zrka2 (4zrk A:104-214)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697426Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2697469Superfamily a.11.2: Second domain of FERM [47031] (2 families) (S)
    automatically mapped to Pfam PF00373
  5. 2697545Family a.11.2.0: automated matches [254193] (1 protein)
    not a true family
  6. 2697546Protein automated matches [254423] (5 species)
    not a true protein
  7. 2697620Species Mouse (Mus musculus) [TaxId:10090] [255101] (5 PDB entries)
  8. 2697628Domain d4zrka2: 4zrk A:104-214 [274131]
    Other proteins in same PDB: d4zrka1, d4zrka3, d4zrkb1, d4zrkb3, d4zrkc1, d4zrkc3, d4zrkd1, d4zrkd3
    automated match to d1h4ra1

Details for d4zrka2

PDB Entry: 4zrk (more details), 2.32 Å

PDB Description: merlin-ferm and lats1 complex
PDB Compounds: (A:) merlin

SCOPe Domain Sequences for d4zrka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zrka2 a.11.2.0 (A:104-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
naeeelvqeitqhlfflqvkkqildekvycppeasvllasyavqakygdydpsvhkrgfl
aqeellpkrvinlyqmtpemweeritawyaehrgrardeaemeylkiaqdl

SCOPe Domain Coordinates for d4zrka2:

Click to download the PDB-style file with coordinates for d4zrka2.
(The format of our PDB-style files is described here.)

Timeline for d4zrka2: