![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies) core: 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.11.2: Second domain of FERM [47031] (2 families) ![]() automatically mapped to Pfam PF00373 |
![]() | Family a.11.2.0: automated matches [254193] (1 protein) not a true family |
![]() | Protein automated matches [254423] (5 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [255101] (5 PDB entries) |
![]() | Domain d4zrkb2: 4zrk B:104-214 [274121] Other proteins in same PDB: d4zrka1, d4zrka3, d4zrkb1, d4zrkb3, d4zrkc1, d4zrkc3, d4zrkd1, d4zrkd3 automated match to d1h4ra1 |
PDB Entry: 4zrk (more details), 2.32 Å
SCOPe Domain Sequences for d4zrkb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zrkb2 a.11.2.0 (B:104-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]} naeeelvqeitqhlfflqvkkqildekvycppeasvllasyavqakygdydpsvhkrgfl aqeellpkrvinlyqmtpemweeritawyaehrgrardeaemeylkiaqdl
Timeline for d4zrkb2: