SCOPe 2.07: Domain d4zjrc1: 4zjr C:265-483

Lineage for d4zjrc1 (4zjr C:265-483)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.0: automated matches [191623] (1 protein)
   not a true family

6. Protein automated matches [191142] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189274] (104 PDB entries)

8. Domain d4zjrc1: 4zjr C:265-483 [274103]
   Other proteins in same PDB: d4zjrc2, d4zjrd2
   automated match to d4nb6b_
   complexed with 4p3

Details for d4zjrc1

PDB Entry: 4zjr, 2.7 Å

PDB Description: rorgamma in complex with inverse agonist 48

PDB Compounds: (C:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d4zjrc1:

Sequence; same for both SEQRES and ATOM records:

>d4zjrc1 a.123.1.0 (C:265-483) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
nlelafhhhlckthrqsilaklppkgklrslcsqhverl

Timeline for d4zjrc1:

• d4zjrc1 first appeared in SCOPe 2.05, called d4zjrc_
  
• d4zjrc1 appears in SCOPe 2.06
  
• d4zjrc1 appears in the current release, SCOPe 2.08