| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) ![]() |
| Family a.123.1.0: automated matches [191623] (1 protein) not a true family |
| Protein automated matches [191142] (5 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [189274] (121 PDB entries) |
| Domain d4zjrc1: 4zjr C:265-483 [274103] Other proteins in same PDB: d4zjrc2, d4zjrd2 automated match to d4nb6b_ complexed with 4p3 |
PDB Entry: 4zjr (more details), 2.7 Å
SCOPe Domain Sequences for d4zjrc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zjrc1 a.123.1.0 (C:265-483) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
nlelafhhhlckthrqsilaklppkgklrslcsqhverl
Timeline for d4zjrc1:
View in 3DDomains from other chains: (mouse over for more information) d4zjra_, d4zjrb_, d4zjrd1, d4zjrd2 |