SCOPe 2.05: Domain d4zjrc_: 4zjr C:

Lineage for d4zjrc_ (4zjr C:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.0: automated matches [191623] (1 protein)
   not a true family

6. Protein automated matches [191142] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189274] (19 PDB entries)

8. Domain d4zjrc_: 4zjr C: [274103]
   automated match to d4nb6b_
   complexed with 4p3

Details for d4zjrc_

PDB Entry: 4zjr, 2.7 Å

PDB Description: rorgamma in complex with inverse agonist 48

PDB Compounds: (C:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d4zjrc_:

Sequence; same for both SEQRES and ATOM records:

>d4zjrc_ a.123.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
saslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahh
lteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyg
gmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlq
ynlelafhhhlckthrqsilaklppkgklrslcsqhverl

Timeline for d4zjrc_:

• d4zjrc_ is new in SCOPe 2.05-stable
  
• d4zjrc_ is called d4zjrc1 in SCOPe 2.06
  
• d4zjrc_ appears in the current release, SCOPe 2.08, called d4zjrc1