Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries) |
Domain d4y8mq1: 4y8m Q:1-234 [273993] Other proteins in same PDB: d4y8ma_, d4y8mc2, d4y8me_, d4y8mg_, d4y8mi_, d4y8mj_, d4y8mk_, d4y8ml_, d4y8mn_, d4y8mo_, d4y8mq2, d4y8ms_, d4y8mu_, d4y8mw_, d4y8mx_, d4y8my_, d4y8mz_ automated match to d1rypd_ complexed with cl, mg; mutant |
PDB Entry: 4y8m (more details), 2.8 Å
SCOPe Domain Sequences for d4y8mq1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4y8mq1 d.153.1.4 (Q:1-234) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqi
Timeline for d4y8mq1:
View in 3D Domains from other chains: (mouse over for more information) d4y8ma_, d4y8mb_, d4y8mc1, d4y8mc2, d4y8md_, d4y8me_, d4y8mf_, d4y8mg_, d4y8mh_, d4y8mi_, d4y8mj_, d4y8mk_, d4y8ml_, d4y8mm_, d4y8mn_, d4y8mo_, d4y8mp_, d4y8mr_, d4y8ms_, d4y8mt_, d4y8mu_, d4y8mv_, d4y8mw_, d4y8mx_, d4y8my_, d4y8mz_ |