Lineage for d4y8mh_ (4y8m H:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (202 PDB entries)
  8. 2994569Domain d4y8mh_: 4y8m H: [273982]
    Other proteins in same PDB: d4y8ma_, d4y8mc2, d4y8me_, d4y8mg_, d4y8mi_, d4y8mj_, d4y8mk_, d4y8ml_, d4y8mn_, d4y8mo_, d4y8mq2, d4y8ms_, d4y8mu_, d4y8mw_, d4y8mx_, d4y8my_, d4y8mz_
    automated match to d4r17h_
    complexed with cl, mg; mutant

Details for d4y8mh_

PDB Entry: 4y8m (more details), 2.8 Å

PDB Description: yeast 20s proteasome beta7-delta7_cter mutant
PDB Compounds: (H:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d4y8mh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y8mh_ d.153.1.4 (H:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee

SCOPe Domain Coordinates for d4y8mh_:

Click to download the PDB-style file with coordinates for d4y8mh_.
(The format of our PDB-style files is described here.)

Timeline for d4y8mh_: