Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.1: Profilin (actin-binding protein) [55770] (2 families) alpha-beta(2)-alpha-beta(5)-alpha |
Family d.110.1.1: Profilin (actin-binding protein) [55771] (2 proteins) automatically mapped to Pfam PF00235 |
Protein automated matches [190412] (11 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187287] (9 PDB entries) |
Domain d4x25a_: 4x25 A: [273784] automated match to d2vk3a_ mutant |
PDB Entry: 4x25 (more details), 2.23 Å
SCOPe Domain Sequences for d4x25a_:
Sequence, based on SEQRES records: (download)
>d4x25a_ d.110.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} agwnayidnlmadgtcqdaaivgykdspsvwaavpgktfvnitpaevgvlvgkdrssfyv ngltlggqkcsvirdsllqdgefsmdlrtkstggaptfnvtvtktdktlvlltgkegvhg glinkkcyemashlrrsqy
>d4x25a_ d.110.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} agwnayidnlmadgtcqdaaivgykdspsvwaavpgktfvnitpaevgvlvgkdrssfyv ngltlggqkcsvirdsllqdgefsmdlrtkstfnvtvtktdktlvlltgkegvhgglink kcyemashlrrsqy
Timeline for d4x25a_: