Lineage for d4z7vc1 (4z7v C:2-81)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2938649Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2938650Protein automated matches [226842] (5 species)
    not a true protein
  7. 2938673Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)
  8. 2938815Domain d4z7vc1: 4z7v C:2-81 [273569]
    Other proteins in same PDB: d4z7va2, d4z7vb2, d4z7vc2, d4z7vd2, d4z7ve1, d4z7ve2, d4z7vf1, d4z7vf2, d4z7vg1, d4z7vg2, d4z7vh1, d4z7vh2
    automated match to d1uvqa2
    complexed with nag

Details for d4z7vc1

PDB Entry: 4z7v (more details), 2.65 Å

PDB Description: l3-12 complex
PDB Compounds: (C:) MHC class II HLA-DQ-alpha chain

SCOPe Domain Sequences for d4z7vc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z7vc1 d.19.1.0 (C:2-81) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vadhvasygvnlyqsygpsgqyshefdgdeefyvdlerketvwqlplfrrfrrfdpqfal
tniavlkhnlnivikrsnsta

SCOPe Domain Coordinates for d4z7vc1:

Click to download the PDB-style file with coordinates for d4z7vc1.
(The format of our PDB-style files is described here.)

Timeline for d4z7vc1: