SCOPe 2.08: Domain d4z7vh1: 4z7v H:2-128

Lineage for d4z7vh1 (4z7v H:2-128)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4z7vh1: 4z7v H:2-128 [273580]
   Other proteins in same PDB: d4z7va1, d4z7va2, d4z7vb1, d4z7vc1, d4z7vc2, d4z7vd1, d4z7ve2, d4z7vg2
   automated match to d2axha1
   complexed with nag

Details for d4z7vh1

PDB Entry: 4z7v, 2.65 Å

PDB Description: l3-12 complex

PDB Compounds: (H:) T-cell receptor, l3-12 beta chain

SCOPe Domain Sequences for d4z7vh1:

Sequence; same for both SEQRES and ATOM records:

>d4z7vh1 b.1.1.0 (H:2-128) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sgvtqtpkhlitatgqrvtlrcsprsgdlsvywyqqsldqglqfliqyyngeerakgnil
erfsaqqfpdlhselnlsslelgdsalyfcassagtsgeyeqyfgpgtrltvte

Timeline for d4z7vh1:

• d4z7vh1 first appeared in SCOPe 2.05
  
• d4z7vh1 appears in SCOPe 2.07