SCOPe 2.08: Domain d4z7ve2: 4z7v E:129-217

Lineage for d4z7ve2 (4z7v E:129-217)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

Domain d4z7ve2: 4z7v E:129-217 [273587]
Other proteins in same PDB: d4z7va1, d4z7vb1, d4z7vb2, d4z7vc1, d4z7vd1, d4z7vd2, d4z7ve1, d4z7vf1, d4z7vf2, d4z7vg1, d4z7vh1, d4z7vh2
automated match to d2ak4d2
complexed with nag

Details for d4z7ve2

PDB Entry: 4z7v (more details), 2.65 Å

PDB Description: l3-12 complex

PDB Compounds: (E:) T-cell receptor, l3-12 alpha chain

SCOPe Domain Sequences for d4z7ve2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z7ve2 b.1.1.2 (E:129-217) automated matches {Human (Homo sapiens) [TaxId: 9606]}
niqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksn
savawsnksdfacanafnnsiipedtffp

SCOPe Domain Coordinates for d4z7ve2:

Click to download the PDB-style file with coordinates for d4z7ve2.
(The format of our PDB-style files is described here.)

Timeline for d4z7ve2: