Lineage for d4z7vh2 (4z7v H:129-256)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2757108Domain d4z7vh2: 4z7v H:129-256 [273581]
    Other proteins in same PDB: d4z7va1, d4z7va2, d4z7vb1, d4z7vc1, d4z7vc2, d4z7vd1, d4z7ve2, d4z7vg2
    automated match to d2vlme2
    complexed with nag

Details for d4z7vh2

PDB Entry: 4z7v (more details), 2.65 Å

PDB Description: l3-12 complex
PDB Compounds: (H:) T-cell receptor, l3-12 beta chain

SCOPe Domain Sequences for d4z7vh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z7vh2 b.1.1.0 (H:129-256) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

SCOPe Domain Coordinates for d4z7vh2:

Click to download the PDB-style file with coordinates for d4z7vh2.
(The format of our PDB-style files is described here.)

Timeline for d4z7vh2: