SCOPe 2.08: Domain d2n1te1: 2n1t E:271-418

Lineage for d2n1te1 (2n1t E:271-418)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families)
   two constituent families are related by circular permutation

5. Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
   topologically similar to the C-terminal domain of PapD

6. Protein automated matches [190234] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188037] (3 PDB entries)

8. Domain d2n1te1: 2n1t E:271-418 [273434]
   Other proteins in same PDB: d2n1ta_, d2n1tb_, d2n1tc_, d2n1td_, d2n1te2
   automated match to d1tjxa_

Details for d2n1te1

PDB Entry: 2n1t

PDB Description: dynamic binding mode of a synaptotagmin-1-snare complex in solution

PDB Compounds: (E:) Synaptotagmin-1

SCOPe Domain Sequences for d2n1te1:

Sequence; same for both SEQRES and ATOM records:

>d2n1te1 b.7.1.2 (E:271-418) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eklgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkrlkkkktti
kkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgynstgaelrhw
sdmlanprrpiaqwhtlqveeevdamla

Timeline for d2n1te1:

• d2n1te1 first appeared in SCOPe 2.05, called d2n1te_
  
• d2n1te1 appears in SCOPe 2.07