![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
![]() | Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) ![]() two constituent families are related by circular permutation |
![]() | Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins) topologically similar to the C-terminal domain of PapD |
![]() | Protein automated matches [190234] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188037] (3 PDB entries) |
![]() | Domain d2n1te1: 2n1t E:271-418 [273434] Other proteins in same PDB: d2n1ta_, d2n1tb_, d2n1tc_, d2n1td_, d2n1te2 automated match to d1tjxa_ |
PDB Entry: 2n1t (more details)
SCOPe Domain Sequences for d2n1te1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2n1te1 b.7.1.2 (E:271-418) automated matches {Human (Homo sapiens) [TaxId: 9606]} eklgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkrlkkkktti kkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgynstgaelrhw sdmlanprrpiaqwhtlqveeevdamla
Timeline for d2n1te1:
![]() Domains from other chains: (mouse over for more information) d2n1ta_, d2n1tb_, d2n1tc_, d2n1td_ |