Lineage for d2n1te1 (2n1t E:271-418)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2772794Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2772795Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) (S)
    two constituent families are related by circular permutation
  5. 2772956Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
    topologically similar to the C-terminal domain of PapD
  6. 2773040Protein automated matches [190234] (2 species)
    not a true protein
  7. 2773041Species Human (Homo sapiens) [TaxId:9606] [188037] (3 PDB entries)
  8. 2773046Domain d2n1te1: 2n1t E:271-418 [273434]
    Other proteins in same PDB: d2n1ta_, d2n1tb_, d2n1tc_, d2n1td_, d2n1te2
    automated match to d1tjxa_

Details for d2n1te1

PDB Entry: 2n1t (more details)

PDB Description: dynamic binding mode of a synaptotagmin-1-snare complex in solution
PDB Compounds: (E:) Synaptotagmin-1

SCOPe Domain Sequences for d2n1te1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2n1te1 b.7.1.2 (E:271-418) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eklgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkrlkkkktti
kkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgynstgaelrhw
sdmlanprrpiaqwhtlqveeevdamla

SCOPe Domain Coordinates for d2n1te1:

Click to download the PDB-style file with coordinates for d2n1te1.
(The format of our PDB-style files is described here.)

Timeline for d2n1te1: