| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.15: SNARE fusion complex [58038] (2 families) ![]() tetrameric parallel coiled coil |
| Family h.1.15.1: SNARE fusion complex [58039] (12 proteins) |
| Protein automated matches [254664] (2 species) not a true protein |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [256060] (5 PDB entries) |
| Domain d2n1tb_: 2n1t B: [273432] Other proteins in same PDB: d2n1ta_, d2n1tc_, d2n1td_, d2n1te1, d2n1te2 automated match to d1sfcj_ |
PDB Entry: 2n1t (more details)
SCOPe Domain Sequences for d2n1tb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2n1tb_ h.1.15.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
skqalseietrhseiiklensirelhdmfmdmamlvesqgemidrieynvehavdyvera
vsdtkkavkyqs
Timeline for d2n1tb_: