Lineage for d1tjxa_ (1tjx A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1775883Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 1775884Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 1776026Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
    topologically similar to the C-terminal domain of PapD
  6. 1776050Protein Synaptogamin I [49576] (2 species)
    duplication: contains tandem repeat of two similar domains
  7. 1776067Species Norway rat (Rattus norvegicus) [TaxId:10116] [49577] (7 PDB entries)
    Uniprot P21707 271-419 ! Uniprot P21707 271-419
  8. 1776068Domain d1tjxa_: 1tjx A: [112465]
    complexed with act, ca, gol

Details for d1tjxa_

PDB Entry: 1tjx (more details), 1.04 Å

PDB Description: Crystallographic Identification of Ca2+ Coordination Sites in Synaptotagmin I C2B Domain
PDB Compounds: (A:) similar to synaptotagminI/p65

SCOPe Domain Sequences for d1tjxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tjxa_ b.7.1.2 (A:) Synaptogamin I {Norway rat (Rattus norvegicus) [TaxId: 10116]}
sgggggileklgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkr
lkkkkttikkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgyns
tgaelrhwsdmlanprrpiaqwhtlqveeevdamlav

SCOPe Domain Coordinates for d1tjxa_:

Click to download the PDB-style file with coordinates for d1tjxa_.
(The format of our PDB-style files is described here.)

Timeline for d1tjxa_: