SCOPe 2.08: Domain d1tjxa1: 1tjx A:271-419

Lineage for d1tjxa1 (1tjx A:271-419)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families)
   two constituent families are related by circular permutation

5. Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
   topologically similar to the C-terminal domain of PapD

6. Protein Synaptogamin I [49576] (3 species)
   duplication: contains tandem repeat of two similar domains

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [49577] (12 PDB entries)
   Uniprot P21707 271-419 ! Uniprot P21707 271-419

8. Domain d1tjxa1: 1tjx A:271-419 [112465]
   Other proteins in same PDB: d1tjxa2
   complexed with act, ca, gol

Details for d1tjxa1

PDB Entry: 1tjx, 1.04 Å

PDB Description: Crystallographic Identification of Ca2+ Coordination Sites in Synaptotagmin I C2B Domain

PDB Compounds: (A:) similar to synaptotagminI/p65

SCOPe Domain Sequences for d1tjxa1:

Sequence; same for both SEQRES and ATOM records:

>d1tjxa1 b.7.1.2 (A:271-419) Synaptogamin I {Norway rat (Rattus norvegicus) [TaxId: 10116]}
eklgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkrlkkkktti
kkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgynstgaelrhw
sdmlanprrpiaqwhtlqveeevdamlav

Timeline for d1tjxa1:

• d1tjxa1 first appeared in SCOP 1.71, called d1tjxa_
  
• d1tjxa1 appears in SCOPe 2.07