PDB entry 2n1t

View 2n1t on RCSB PDB site
Description: Dynamic binding mode of a synaptotagmin-1-SNARE complex in solution
Class: exocytosis
Keywords: Synaptotagmin-1, C2B domain, Syntaxin-1A, Synaptobrevin-2, SNAP-25, SNAP-25A, SNARE complex, EXOCYTOSIS
Deposited on 2015-04-21, released 2015-06-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-07-22, with a file datestamp of 2015-07-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vesicle-associated membrane protein 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Syb2, Vamp2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2n1ta_
  • Chain 'B':
    Compound: syntaxin-1a
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Sap, Stx1a
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2n1tb_
  • Chain 'C':
    Compound: synaptosomal-associated protein 25
    Species: Homo sapiens [TaxId:9606]
    Gene: SNAP, SNAP25, SNAP-25A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2n1tc_
  • Chain 'D':
    Compound: synaptosomal-associated protein 25
    Species: Homo sapiens [TaxId:9606]
    Gene: SNAP, SNAP25, SNAP-25A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2n1td_
  • Chain 'E':
    Compound: Synaptotagmin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: SVP65, SYT, SYT1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21579 (8-155)
      • expression tag (0-7)
    Domains in SCOPe 2.08: d2n1te1, d2n1te2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2n1tA (A:)
nltsnrrlqqtqaqvdevvdimrvnvdkvlerdqklselddradalqagasqfetsaakl
krkywwknl

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2n1tB (B:)
skqalseietrhseiiklensirelhdmfmdmamlvesqgemidrieynvehavdyvera
vsdtkkavkyqs

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2n1tC (C:)
mrneleemqrradqladeslestrrmlqlveeskdagirtlvmldeqgeqldrveegmnh
inqdmkeaeknlkdlgk

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2n1tD (D:)
ggfirrvtndarenemdenleqvsgiignlrhmaldmgneidtqnrqidrimekadsnkt
rideanqratkmlg

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2n1tE (E:)
sgggggileklgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkr
lkkkkttikkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgyns
tgaelrhwsdmlanprrpiaqwhtlqveeevdamla