SCOPe 2.08: Domain d4rmpa1: 4rmp A:9-161

Lineage for d4rmpa1 (4rmp A:9-161)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore
   automatically mapped to Pfam PF00502

6. Protein automated matches [190531] (23 species)
   not a true protein

7. Species Phormidium rubidum [TaxId:865859] [272704] (5 PDB entries)

8. Domain d4rmpa1: 4rmp A:9-161 [272706]
   Other proteins in same PDB: d4rmpa2, d4rmpb2
   automated match to d3dbja_
   complexed with cyc

Details for d4rmpa1

PDB Entry: 4rmp, 2.51 Å

PDB Description: crystal structure of allophycocyanin from marine cyanobacterium phormidium sp. a09dm

PDB Compounds: (A:) allophycocyanin

SCOPe Domain Sequences for d4rmpa1:

Sequence; same for both SEQRES and ATOM records:

>d4rmpa1 a.1.1.3 (A:9-161) automated matches {Phormidium rubidum [TaxId: 865859]}
vnadaearylspgeldrikgfvtsgerrlriaqvltesrerivkqagdqlfqkrpdvvsp
ggnaygeemtatclrdmdyylrlitygvvagdvtpieeiglvgvremynslgtpipavae
avrcmksvassllsgedaaeaasyfdyvvgamq

Timeline for d4rmpa1:

• d4rmpa1 first appeared in SCOPe 2.05, called d4rmpa_
  
• d4rmpa1 appears in SCOPe 2.07