SCOP 1.63: Domain d1vwjb_: 1vwj B:

Lineage for d1vwjb_ (1vwj B:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.61: Streptavidin-like [50875] (5 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (1 family)

5. Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (92 PDB entries)

8. Domain d1vwjb_: 1vwj B: [27268]

Details for d1vwjb_

PDB Entry: 1vwj, 1.45 Å

PDB Description: streptavidin-cyclo-[5-s-valeramide-hpqgppc]k-nh2, ph 2.5, i222 complex

SCOP Domain Sequences for d1vwjb_:

Sequence; same for both SEQRES and ATOM records:

>d1vwjb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
vkp

Timeline for d1vwjb_:

• d1vwjb_ first appeared (with stable ids) in SCOP 1.55
  
• d1vwjb_ appears in SCOP 1.61
  
• d1vwjb_ appears in SCOP 1.65
  
• d1vwjb_ appears in the current release, SCOPe 2.08