Lineage for d1vwjb_ (1vwj B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2805786Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2805787Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2805788Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 2805820Protein Streptavidin [50878] (1 species)
  7. 2805821Species Streptomyces avidinii [TaxId:1895] [50879] (128 PDB entries)
  8. 2805883Domain d1vwjb_: 1vwj B: [27268]
    complexed with lea

Details for d1vwjb_

PDB Entry: 1vwj (more details), 1.45 Å

PDB Description: streptavidin-cyclo-[5-s-valeramide-hpqgppc]k-nh2, ph 2.5, i222 complex
PDB Compounds: (B:) streptavidin

SCOPe Domain Sequences for d1vwjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vwjb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
aeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
vkp

SCOPe Domain Coordinates for d1vwjb_:

Click to download the PDB-style file with coordinates for d1vwjb_.
(The format of our PDB-style files is described here.)

Timeline for d1vwjb_: