SCOPe 2.08: Domain d4nhub2: 4nhu B:112-239

Lineage for d4nhub2 (4nhu B:112-239)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d4nhub2: 4nhu B:112-239 [272274]
   Other proteins in same PDB: d4nhua2, d4nhua3, d4nhuc2, d4nhuc3
   automated match to d3q5ya2

Details for d4nhub2

PDB Entry: 4nhu, 2.9 Å

PDB Description: the m33 tcr p3m33l/h-2 ld complex

PDB Compounds: (B:) 2C m33 beta VmCh chimera

SCOPe Domain Sequences for d4nhub2:

Sequence; same for both SEQRES and ATOM records:

>d4nhub2 b.1.1.0 (B:112-239) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

Timeline for d4nhub2:

• d4nhub2 first appeared in SCOPe 2.05
  
• d4nhub2 appears in SCOPe 2.07