Lineage for d4nhua2 (4nhu A:113-199)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (14 species)
    not a true protein
  7. 2025381Species Mouse (Mus musculus) [TaxId:10090] [224855] (494 PDB entries)
  8. 2026018Domain d4nhua2: 4nhu A:113-199 [272272]
    Other proteins in same PDB: d4nhua1, d4nhub1, d4nhub2, d4nhuc1, d4nhud1, d4nhud2
    automated match to d2f54d2

Details for d4nhua2

PDB Entry: 4nhu (more details), 2.9 Å

PDB Description: the m33 tcr p3m33l/h-2 ld complex
PDB Compounds: (A:) 2C m33 alpha VmCh chimera

SCOPe Domain Sequences for d4nhua2:

Sequence, based on SEQRES records: (download)

>d4nhua2 b.1.1.2 (A:113-199) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtff

Sequence, based on observed residues (ATOM records): (download)

>d4nhua2 b.1.1.2 (A:113-199) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnsiipedtff

SCOPe Domain Coordinates for d4nhua2:

Click to download the PDB-style file with coordinates for d4nhua2.
(The format of our PDB-style files is described here.)

Timeline for d4nhua2: