Lineage for d4nhud2 (4nhu D:112-239)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2357727Species Mouse (Mus musculus) [TaxId:10090] [188198] (598 PDB entries)
  8. 2358622Domain d4nhud2: 4nhu D:112-239 [272270]
    Other proteins in same PDB: d4nhua2, d4nhua3, d4nhuc2, d4nhuc3
    automated match to d3q5ya2

Details for d4nhud2

PDB Entry: 4nhu (more details), 2.9 Å

PDB Description: the m33 tcr p3m33l/h-2 ld complex
PDB Compounds: (D:) 2C m33 beta VmCh chimera

SCOPe Domain Sequences for d4nhud2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nhud2 b.1.1.0 (D:112-239) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

SCOPe Domain Coordinates for d4nhud2:

Click to download the PDB-style file with coordinates for d4nhud2.
(The format of our PDB-style files is described here.)

Timeline for d4nhud2: