Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (26 species) not a true protein |
Species Mus musculus, [TaxId:10090] [272265] (6 PDB entries) |
Domain d4nhub2: 4nhu B:112-239 [272274] Other proteins in same PDB: d4nhua2, d4nhuc2 automated match to d3q5ya2 |
PDB Entry: 4nhu (more details), 2.9 Å
SCOPe Domain Sequences for d4nhub2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nhub2 b.1.1.0 (B:112-239) automated matches {Mus musculus, [TaxId: 10090]} dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv saeawgra
Timeline for d4nhub2: