SCOPe 2.05: Domain d4nhuc1: 4nhu C:2-112

Lineage for d4nhuc1 (4nhu C:2-112)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Mus musculus, [TaxId:10090] [272265] (6 PDB entries)

8. Domain d4nhuc1: 4nhu C:2-112 [272266]
   Other proteins in same PDB: d4nhua2, d4nhuc2
   automated match to d2f54d1

Details for d4nhuc1

PDB Entry: 4nhu, 2.9 Å

PDB Description: the m33 tcr p3m33l/h-2 ld complex

PDB Compounds: (C:) 2C m33 alpha VmCh chimera

SCOPe Domain Sequences for d4nhuc1:

Sequence; same for both SEQRES and ATOM records:

>d4nhuc1 b.1.1.0 (C:2-112) automated matches {Mus musculus, [TaxId: 10090]}
svtqpdarvtvsegaslqlrckysysatpylfwyvqyprqglqlllkyysgdpvvqgvng
feaefsksnssfhlrkasvhwsdsavyfcavslhrpaltfgsgtkvivlpn

Timeline for d4nhuc1:

• d4nhuc1 is new in SCOPe 2.05-stable
  
• d4nhuc1 appears in SCOPe 2.06
  
• d4nhuc1 appears in the current release, SCOPe 2.08