SCOP 1.63: Domain d2cbsa_: 2cbs A:

Lineage for d2cbsa_ (2cbs A:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (3 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (13 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Cellular retinoic-acid-binding protein (CRABP) [50861] (2 species)

7. Species Human (Homo sapiens), CRABP-II [TaxId:9606] [50862] (7 PDB entries)

8. Domain d2cbsa_: 2cbs A: [27203]

Details for d2cbsa_

PDB Entry: 2cbs, 2.1 Å

PDB Description: cellular retinoic acid binding protein ii in complex with a synthetic retinoic acid (ro-13 6307)

SCOP Domain Sequences for d2cbsa_:

Sequence; same for both SEQRES and ATOM records:

>d2cbsa_ b.60.1.2 (A:) Cellular retinoic-acid-binding protein (CRABP) {Human (Homo sapiens), CRABP-II}
pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvrt
teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtreltndgeli
ltmtaddvvctrvyvre

Timeline for d2cbsa_:

• d2cbsa_ first appeared (with stable ids) in SCOP 1.55
  
• d2cbsa_ appears in SCOP 1.61
  
• d2cbsa_ appears in SCOP 1.65
  
• d2cbsa_ appears in the current release, SCOPe 2.08