Lineage for d2cbsa_ (2cbs A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 300926Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 300927Superfamily b.60.1: Lipocalins [50814] (3 families) (S)
    bind hydrophobic ligands in their interior
  5. 301112Family b.60.1.2: Fatty acid binding protein-like [50847] (15 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 301137Protein Cellular retinoic-acid-binding protein (CRABP) [50861] (2 species)
  7. 301144Species Human (Homo sapiens), CRABP-II [TaxId:9606] [50862] (7 PDB entries)
  8. 301147Domain d2cbsa_: 2cbs A: [27203]

Details for d2cbsa_

PDB Entry: 2cbs (more details), 2.1 Å

PDB Description: cellular retinoic acid binding protein ii in complex with a synthetic retinoic acid (ro-13 6307)

SCOP Domain Sequences for d2cbsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cbsa_ b.60.1.2 (A:) Cellular retinoic-acid-binding protein (CRABP) {Human (Homo sapiens), CRABP-II}
pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvrt
teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtreltndgeli
ltmtaddvvctrvyvre

SCOP Domain Coordinates for d2cbsa_:

Click to download the PDB-style file with coordinates for d2cbsa_.
(The format of our PDB-style files is described here.)

Timeline for d2cbsa_: