SCOP 1.63: Domain d1ael__: 1ael -

Lineage for d1ael__ (1ael -)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (3 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (13 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Intestinal fatty acid binding protein [50851] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [50852] (9 PDB entries)

8. Domain d1ael__: 1ael - [27180]

Details for d1ael__

PDB Entry: 1ael

PDB Description: nmr structure of apo intestinal fatty acid-binding protein, 20 structures

SCOP Domain Sequences for d1ael__:

Sequence; same for both SEQRES and ATOM records:

>d1ael__ b.60.1.2 (-) Intestinal fatty acid binding protein {Rat (Rattus norvegicus)}
afdgtwkvdrnenyekfmekmginvvkrklgahdnlkltitqegnkftvkessnfrnidv
vfelgvdfaysladgteltgtwtmegnklvgkfkrvdngkeliavreisgneliqtytye
gveakrifkke

Timeline for d1ael__:

• d1ael__ first appeared (with stable ids) in SCOP 1.55
  
• d1ael__ appears in SCOP 1.61
  
• d1ael__ appears in SCOP 1.65
  
• d1ael__ appears in the current release, SCOPe 2.08, called d1aela_