Lineage for d1ael__ (1ael -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 16455Fold b.60: Lipocalins [50813] (1 superfamily)
  4. 16456Superfamily b.60.1: Lipocalins [50814] (3 families) (S)
  5. 16579Family b.60.1.2: Fatty acid binding protein-like [50847] (10 proteins)
  6. 16636Protein Intestinal fatty acid binding protein [50851] (2 species)
  7. 16639Species Rat (Rattus norvegicus) [TaxId:10116] [50852] (9 PDB entries)
  8. 16648Domain d1ael__: 1ael - [27180]

Details for d1ael__

PDB Entry: 1ael (more details)

PDB Description: nmr structure of apo intestinal fatty acid-binding protein, 20 structures

SCOP Domain Sequences for d1ael__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ael__ b.60.1.2 (-) Intestinal fatty acid binding protein {Rat (Rattus norvegicus)}
afdgtwkvdrnenyekfmekmginvvkrklgahdnlkltitqegnkftvkessnfrnidv
vfelgvdfaysladgteltgtwtmegnklvgkfkrvdngkeliavreisgneliqtytye
gveakrifkke

SCOP Domain Coordinates for d1ael__:

Click to download the PDB-style file with coordinates for d1ael__.
(The format of our PDB-style files is described here.)

Timeline for d1ael__: