SCOP 1.63: Domain d4np1b_: 4np1 B:

Lineage for d4np1b_ (4np1 B:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (3 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (16 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Nitrophorin 1 [50841] (1 species)

7. Species Rhodnius prolixus [TaxId:13249] [50842] (4 PDB entries)

8. Domain d4np1b_: 4np1 B: [27162]
   complexed with hem, nmo, phs, po4

Details for d4np1b_

PDB Entry: 4np1, 2.3 Å

PDB Description: nitrophorin 1 complex with nitric oxide

SCOP Domain Sequences for d4np1b_:

Sequence; same for both SEQRES and ATOM records:

>d4np1b_ b.60.1.1 (B:) Nitrophorin 1 {Rhodnius prolixus}
kctknalaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
dpktqdtfydvselqeespgkytanfkkvekngnvkvdvtsgnyytftvmyaddssalih
tclhkgnkdlgdlyavlnrnkdtnagdkvkgavtaaslkfsdfistkdnkceydnvslks
lltk

Timeline for d4np1b_:

• d4np1b_ first appeared (with stable ids) in SCOP 1.55
  
• d4np1b_ appears in SCOP 1.61
  
• d4np1b_ appears in SCOP 1.65
  
• d4np1b_ appears in the current release, SCOPe 2.08