Class b: All beta proteins [48724] (126 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (3 families) bind hydrophobic ligands in their interior |
Family b.60.1.1: Retinol binding protein-like [50815] (17 proteins) barrel, closed; n=8, S=12, meander |
Protein Nitrophorin 1 [50841] (1 species) |
Species Rhodnius prolixus [TaxId:13249] [50842] (4 PDB entries) |
Domain d4np1b_: 4np1 B: [27162] complexed with hem, nmo, phs, po4 |
PDB Entry: 4np1 (more details), 2.3 Å
SCOP Domain Sequences for d4np1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4np1b_ b.60.1.1 (B:) Nitrophorin 1 {Rhodnius prolixus} kctknalaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy dpktqdtfydvselqeespgkytanfkkvekngnvkvdvtsgnyytftvmyaddssalih tclhkgnkdlgdlyavlnrnkdtnagdkvkgavtaaslkfsdfistkdnkceydnvslks lltk
Timeline for d4np1b_: