Lineage for d4np1b_ (4np1 B:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 300926Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 300927Superfamily b.60.1: Lipocalins [50814] (3 families) (S)
    bind hydrophobic ligands in their interior
  5. 300928Family b.60.1.1: Retinol binding protein-like [50815] (17 proteins)
    barrel, closed; n=8, S=12, meander
  6. 301023Protein Nitrophorin 1 [50841] (1 species)
  7. 301024Species Rhodnius prolixus [TaxId:13249] [50842] (4 PDB entries)
  8. 301032Domain d4np1b_: 4np1 B: [27162]
    complexed with hem, nmo, phs, po4

Details for d4np1b_

PDB Entry: 4np1 (more details), 2.3 Å

PDB Description: nitrophorin 1 complex with nitric oxide

SCOP Domain Sequences for d4np1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4np1b_ b.60.1.1 (B:) Nitrophorin 1 {Rhodnius prolixus}
kctknalaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
dpktqdtfydvselqeespgkytanfkkvekngnvkvdvtsgnyytftvmyaddssalih
tclhkgnkdlgdlyavlnrnkdtnagdkvkgavtaaslkfsdfistkdnkceydnvslks
lltk

SCOP Domain Coordinates for d4np1b_:

Click to download the PDB-style file with coordinates for d4np1b_.
(The format of our PDB-style files is described here.)

Timeline for d4np1b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4np1a_