Lineage for d1epaa_ (1epa A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.60: Lipocalins [50813] (1 superfamily) Superfamily b.60.1: Lipocalins [50814] (3 families) 
Family b.60.1.1: Retinol binding protein-like [50815] (12 proteins) 
Protein Retinoic acid-binding protein [50830] (1 species) Species Rat (Rattus norvegicus), albino [TaxId:10116] [50831] (2 PDB entries) 
Domain d1epaa_: 1epa A: [27128]
Details for d1epaa_
PDB Entry: 1epa (more details), 2.1 Å
PDB Description: structure of the epididymal retinoic acid-binding protein at 2.1 angstroms resolution
SCOP Domain Sequences for d1epaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1epaa_ b.60.1.1 (A:) Retinoic acid-binding protein {Rat (Rattus norvegicus), albino}
vkdfdiskflgfwyeiafaskmgtpglahkeekmgamvvelkenllaltttyysedhcvl
ekvtategdgpakfqvtrlsgkkevvveatdyltyaiiditslvagavhrtmklysrsld
dngealynfrkitsdhgfsetdlyilkhdltcvkvlqsaa
SCOP Domain Coordinates for d1epaa_:
Click to download the PDB-style file with coordinates for d1epaa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1epaa_:
- d1epaa_ appears in SCOP 1.57
- d1epaa_ appears in the current release, SCOPe 2.08
View in 3D
